PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011089884.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 788aa    MW: 87552.7 Da    PI: 6.5512
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011089884.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B373.32.9e-23152253199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++p++ ae++      +++ + s++l+ +d++g +W++++iyr++++r++lt+GW+ Fv++++L +gD v+F   + + 
  XP_011089884.1 152 FCKTLTASDTSTHGGFSVPRRAAEDCfppldyKEQ-RPSQELIAKDLHGVEWKFRHIYRGQPRRHLLTTGWSIFVSQKNLVSGDAVLFL--RGEA 243
                     99****************************86333.45679************************************************..3488 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     + l+++++r+
  XP_011089884.1 244 GDLRLGIRRA 253
                     8899999986 PP

2Auxin_resp112.73.4e-37278359182
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsL 82 
                     +a+a+s++s+F v+Y+Pras+++F+v+++k++k +++++ vG+Rfkm+f+ +ds+err+sG+v+gv d+dp+rWpnSkWr+L
  XP_011089884.1 278 VANALSSNSTFPVFYSPRASHADFIVPYQKYVKCTTSQIPVGTRFKMRFDFDDSPERRFSGVVTGVGDMDPYRWPNSKWRCL 359
                     689******************************************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019364.97E-44143264IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.8E-40145265IPR015300DNA-binding pseudobarrel domain
CDDcd100175.81E-22150252No hitNo description
SMARTSM010199.7E-23152254IPR003340B3 DNA binding domain
PROSITE profilePS5086312.957152254IPR003340B3 DNA binding domain
PfamPF023623.7E-21152253IPR003340B3 DNA binding domain
PfamPF065073.7E-31278359IPR010525Auxin response factor
PROSITE profilePS5174520.908660742IPR000270PB1 domain
SuperFamilySSF542772.35E-11662739No hitNo description
PfamPF023093.4E-5708745IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0010050Biological Processvegetative phase change
GO:0010158Biological Processabaxial cell fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 788 aa     Download sequence    Send to blast
MEIDLNHAVC EVENSNNASG NGEECDKGEV PAPSSSIYME LWHACAGPLT TLPRKGNVVV  60
YFPQGHLEQA ASASPFPPME MPTFDLPPQI FCRVVDVQLL ANKENDEVYT QLSLLPLSEL  120
VGLKLEGKES ENAGADEDGN GVVPAKSTSH MFCKTLTASD TSTHGGFSVP RRAAEDCFPP  180
LDYKEQRPSQ ELIAKDLHGV EWKFRHIYRG QPRRHLLTTG WSIFVSQKNL VSGDAVLFLR  240
GEAGDLRLGI RRAARPRNGL PDSIIKNQNS YPNVLSPVAN ALSSNSTFPV FYSPRASHAD  300
FIVPYQKYVK CTTSQIPVGT RFKMRFDFDD SPERRFSGVV TGVGDMDPYR WPNSKWRCLM  360
VRWNEDIMSN HQERVSPWDI DFSGNYAPLS IQSSPRMKKL RSNLQVPPHD SPVAGGAALL  420
DFEESVRSSK VLQGQENVGL APPLYRSDRI NRQLDFETRP PPPNPVPNRM EKINYGEFVR  480
NQGSATFTGF LESNWFPKVL QGQEICSLRS LAGKTDSSLG AWSKPSLGYN LHNMHQRPTP  540
SFYPLASEGA RNMPIPHNGI YRVGQGPSVL SNFSNFRMGN HALTPTSILS GAAADIGRAP  600
HLTIEPRAQE KTSAPTTSTM HFKNMNNDDN LKEKVPICKI FGFSLTEDPT NLSLQGPSKR  660
SCTKVHKQGS LVGRAIDLSR LHGYDDLLVE LERLFSMEGL LRDPNNGWRI LYTDSENDMM  720
VVGDDPWHEF VEVVTKIHIY TQEEVEKLTI GINSDDTKSC LEEAPPAPDV SKSSSVGQPD  780
SSPTVIRM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldw_B1e-1213438716359Auxin response factor 1
4ldw_A1e-1213438716359Auxin response factor 1
4ldv_A1e-1213438716359Auxin response factor 1
4ldy_B1e-1213438716359Auxin response factor 1
4ldy_A1e-1213438716359Auxin response factor 1
4ldx_B1e-1213438716359Auxin response factor 1
4ldx_A1e-1213438716359Auxin response factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011089884.10.0PREDICTED: auxin response factor 4 isoform X2
SwissprotQ9ZTX90.0ARFD_ARATH; Auxin response factor 4
TrEMBLQ2LAI90.0Q2LAI9_SOLLC; Auxin response factor
STRINGSolyc11g069190.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60450.10.0auxin response factor 4